alpha-MSH raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-04-02 and is reviewed periodically as new material appears.
Scientific discussion of Melanotan-2 spans pharmacology, dermatology, and public-health literature. Laboratory studies examine its receptor binding and cellular effects, while clinical reports describe outcomes observed after unregulated use. These two bodies of work differ in rigour and intent. Peer-reviewed trials of the compound as a medicine are limited, so much of the available information comes from case reports and surveillance data. Authors frequently note the gap between experimental findings and real-world use.
Reported observations after unregulated use include shifts in skin pigmentation and, in some accounts, unintended changes to moles and other lesions. Whether these outcomes are causally linked to the compound, and how often they occur, remain open questions because controlled data are scarce. The absence of standardised dosing and verified product purity complicates interpretation. Researchers have called for better surveillance and analytical characterisation of samples obtained outside regulated channels. Conclusions drawn from anecdotal evidence should be treated as provisional.
Melanotan-2 has not received marketing authorisation from major regulatory agencies for any therapeutic indication. Several jurisdictions classify it as a prescription-only medicine or a controlled substance when supplied for human use. Because approved products do not exist, material sold online usually sits outside pharmaceutical supply chains and formal quality oversight. Regulators have issued public notices describing the compound as unapproved. Enforcement varies, and the legal position differs between countries, which complicates any single general statement about its status.
Melanotan-2, also written Melanotan II, is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone. Its sequence is Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, and the lactam bridge between the aspartate and lysine side chains constrains the peptide into a ring. This structural change increases receptor affinity and metabolic stability relative to the native hormone. The compound was created in the 1980s as a research tool for studying pigmentation biology.
Melanocytes are the pigment-producing cells of the skin, and they carry melanocortin-1 receptors on their surface. When the receptor is activated, cyclic adenosine monophosphate rises inside the cell and raises the activity of enzymes such as tyrosinase, which increases melanin output. Melanotan-2 binds melanocortin-1 receptors in vitro and in animal models, and this binding is generally described as the basis for the tanning effect. Other receptors account for different effects: melanocortin-4 receptors contribute to appetite and erectile signalling, while melanocortin-3 and melanocortin-5 receptors contribute to energy balance and exocrine function.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Unapproved for therapeutic use | No marketing authorisation from major agencies |
| Legal classification | Varies by jurisdiction | Prescription-only or controlled in several countries |
| Common synonyms | Melanotan II; MT-II | Also referenced by catalogue codes |
| Typical analytical method | Reverse-phase HPLC | Often paired with mass spectrometry |
| Primary literature focus | Receptor pharmacology | Pigmentation and melanocortin signalling |
Identity and purity are assessed with chromatographic and mass spectrometric techniques. Reversed-phase high-performance liquid chromatography separates the target peptide from related impurities and degradation products, and the resulting retention time is compared against a reference standard. Mass spectrometry, often coupled to liquid chromatography, confirms molecular mass. Amino acid analysis or peptide mapping can provide additional sequence-level confirmation when required. Results are only as reliable as the reference materials used alongside them.
Regulatory treatment varies by country. In the United States, melanotan-2 is not approved for any indication, and products marketed for human use fall outside the approved drug framework. Some other jurisdictions have placed it under prescription controls or listed it as a prohibited or restricted substance. Online listings frequently describe the material as a research chemical, a category that does not carry the same manufacturing and labelling requirements as approved medicines.
Solid peptide material is generally stable when kept cold and dry. Common practice is storage at -20 degrees Celsius or lower, with desiccant and protection from light. Repeated freeze-thaw cycles and exposure to moisture are associated with degradation, aggregation, or loss of material. Once dissolved, stability depends on solvent, concentration, and temperature, and solutions are usually treated as short-lived unless stability data support longer periods. Handling notes typically emphasise minimising time at ambient temperature.
Melanotan II is a synthetic cyclic heptapeptide that acts as an agonist at melanocortin receptors. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous peptide involved in pigment production. The analogue carries a lactam bridge that constrains the ring and slows enzymatic breakdown relative to the native hormone. In research literature it appears under several abbreviations, and naming conventions are not fully standardized. Published descriptions usually place it within the broader melanocortin agonist family.
Receptor binding at MC1R on melanocytes raises intracellular cyclic AMP and increases expression of tyrosinase and related enzymes. The downstream result is greater synthesis of eumelanin, the dark pigment, without ultraviolet exposure acting as the trigger. The compound is not selective, however, and also engages MC3R, MC4R and MC5R, which are expressed in the central nervous system and elsewhere. That lack of selectivity is the explanation usually offered for effects reported outside pigmentation, including appetite suppression and nausea. Selectivity remains a central theme in comparative studies of related peptides.
Human data remain limited and mostly short-term. Reports describe small trials and observational accounts rather than large controlled studies, so questions about dose-response relationships and long-term effects on melanocytes stay open. Whether repeated exposure alters naevus behaviour is not settled in the published record. Researchers also note that self-administered use outside clinical settings makes actual exposure difficult to quantify. Statements about efficacy and safety should therefore be read as preliminary rather than established.
Lyophilised peptide powder is comparatively stable when kept dry, cold and protected from light. Once dissolved, the molecule is exposed to hydrolysis, oxidation and microbial growth, and degradation accelerates at higher temperatures and in alkaline solution. Repeated freeze-thaw cycles concentrate solutes and promote aggregation. Handling guidance for research peptides commonly clusters around freezer temperatures for powder and short refrigerated use for reconstituted solutions, with pH control and sterile technique applied throughout.
Verification of a purchased sample requires documentation linking a batch to a certificate of analysis, and that document should be read for the methods used rather than the headline purity figure. A single chromatographic percentage does not establish identity. Independent laboratories can perform identity and content assays, but no such test establishes that a product is suitable for human use. Claims about efficacy rest largely on small, early studies rather than on replicated controlled trials, and that gap remains open.
Identity testing for a cyclic peptide of this size usually relies on reversed-phase high-performance liquid chromatography coupled to mass spectrometry. The mass spectrum confirms molecular weight, while the chromatographic trace indicates the proportion of related impurities. Tandem mass spectrometry can provide sequence-level information when fragmentation data are compared against a reference standard. Nuclear magnetic resonance is sometimes used to confirm the lactam bridge, although it requires more material and greater operator expertise than routine chromatographic methods.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone, the naturally occurring peptide involved in pigmentation signalling. Its sequence is conventionally written as Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, with a lactam bridge joining the aspartate side chain to the lysine side chain. The empirical formula is C50H69N15O9 and the monoisotopic mass lies near 1023.5 daltons. N-terminal acetylation and the D-configured phenylalanine both increase resistance to enzymatic breakdown compared with the parent hormone.
Pharmacologically, melanotan-2 behaves as a non-selective agonist across the melanocortin receptor family. Binding at MC1R on dermal melanocytes promotes eumelanin synthesis, which underlies the tanning response described in early human work. Activity at the centrally expressed MC4R receptor is associated with reported effects on appetite and erectile function. Because the peptide does not discriminate strongly among receptor subtypes, attributing any single observed effect to one receptor pathway is generally not possible without selective antagonists or receptor knockout models.
Research interest has centred on photoprotection and pigmentation, with a smaller body of work on appetite and sexual function. Published human data remain limited to small, frequently uncontrolled studies, and the compound has never received marketing approval from a national medicines regulator. Most laboratory work treats it as a pharmacological tool for probing melanocortin signalling in cell culture or animal models. Whether pigmentation changes observed in people translate into measurable protection against ultraviolet-induced DNA damage remains an open question.
Zverev is an all-court player and does not aim to be better on any surface in particular. He has said, "I feel like I can play on all surfaces. I've been to two finals or won tournaments on every single surface. I don't feel like I have to focus on one... I feel like I have good chances at all of them." Toni Nadal, the uncle and coach of Rafael Nadal, has praised his ability on hard courts in particular, saying, "His best surface is, in my eyes, the hard court, because he moves better than he does on clay." Six of Zverev's first ten titles came on hard courts, while the other four were on clay. As of 2024, he has yet to win a title on grass, but has reached two finals and defeated Federer on that surface. His best grass tournament remains Halle, in his home country. Zverev has the ability to serve-and-volley as well. His older brother Mischa is regarded as the biggest proponent of this playing style on the modern tour. Although Zverev does not employ this technique as often as his brother, he has shown it can be effective in big matches such as the Madrid Masters final against Dominic Thiem, a player who rarely comes to the net. Zverev's volley and overhead technique are regarded as some of his biggest weaknesses. Zverev was tall but skinny and not very muscular when growing up. His fitness trainer Jez Green has focused on making him stronger and set a goal for him to add 4 kilograms (8.8 lb) of muscle each year.
The divisions between the elite and the lawless led to the formation of a Cossack army, beginning in 1667 under Stenka Razin, and ultimately to the failure of Razin's rebellion. Stenka Razin was born into an elite Cossack family, and had made many diplomatic visits to Moscow before organizing his rebellion. The Cossacks were Razin's main supporters, and followed him during his first Persian campaign in 1667, plundering and pillaging Persian cities on the Caspian Sea. They returned in 1669, ill and hungry, tired from fighting, but rich with plundered goods. Russia tried to gain support from the old Cossacks, asking the ataman, or Cossack chieftain, to prevent Razin from following through with his plans. But the ataman was Razin's godfather, and was swayed by Razin's promise of a share of expedition wealth. His reply was that the elite Cossacks were powerless against the band of rebels. The elite did not see much threat from Razin and his followers either, although they realized he could cause them problems with the Muscovite system if his following developed into a rebellion against the central government. Razin and his followers began to capture cities at the start of the rebellion, in 1669. They seized the towns of Tsaritsyn, Astrakhan, Saratov, and Samara, implementing democratic rule and releasing peasants from slavery as they went. Razin envisioned a united Cossack republic throughout the southern steppe, in which the towns and villages would operate under the democratic, Cossack style of government.
== External links == MedlinePlus Encyclopedia: Gamma-glutamyl transpeptidase (GGT) blood test gamma-Glutamyltransferase at the U.S. National Library of Medicine Medical Subject Headings (MeSH) GGT - Lab Tests Online Overview of all the structural information available in the PDB for UniProt: P19440 (Gamma-glutamyltransferase 1) at the PDBe-KB.
Sources: en.wikipedia.org
=== Grey market use === Suvomipic has attracted an unusual amount of attention for an investigational drug, such as in the r/Tressless subreddit about hair loss on Reddit. A large group of r/Tressless members, having believed that JXL069 is suvomipic, are known to have sourced JXL069 from China in 2025 in an effort to treat their hair loss. This included sending a sample to an analytical testing lab to confirm the compound's authenticity. Pelage Pharmaceuticals says that it does not endorse such use and has explicitly stated that suvomipic is not JXL069. Suvomipic is also said to not be JXL082. In July 2026, the INNTooltip International Nonproprietary Name of suvomipic was published and revealed that suvomipic is in fact JXL069.
=== Post-traumatic stress disorder === Two SSRIs are FDA-approved for PTSD: paroxetine and sertraline. The 2023 VA/DoD guideline for PTSD recommends the SSRIs sertraline and paroxetine as first-line pharmacological treatments when trauma-focused therapy is unavailable or not preferred; evidence for other SSRIs is insufficient, and medications are recommended to be tailored to each patient's individual needs. A 2022 Cochrane review found that SSRIs improve PTSD symptoms in 58% of patients compared with 35% on placebo (RR 0.66) and are considered first-line treatment.
=== Mumps === Mumps is another viral disease that was once very common, especially during childhood. If mumps is acquired by a male who is past puberty, a possible complication is bilateral orchitis, which can in some cases lead to sterility.
Sucre wanted to delay any union of Bolivia with Peru as long as possible (knowing that it would fall under the latter's hegemony when it passed, weakening his government), annex all the territories offered by Ortiz, confront Colombia with Peru, secure his back by agreeing with Chile and Buenos Aires, and separate Arequipa, Cuzco and Puno from Peru. All this is demonstrated when Sucre indicated to Ortiz de Zevallos that: "only under that plan could Bolivia not fear that Peru would absorb it, as happens when a small State links up with a larger and stronger one". As well as when in 1827, Sucre appointed dean Gregorio Funes, a Bolivarian Argentine, who was carrying out the functions of Colombian minister in Buenos Aires, to receive the post of Bolivian minister in the same Argentine capital. Through Funes, Sucre addressed the issue of an alliance between Bolivia, Argentina and Chile, which was supposedly to stop Brazilian expansionism, but in practice he was looking for support against Peru because he knew its weakness against it, and suggested that the participation of Gran Colombia in the war against Brazil could occur through a treaty. From Santiago de Chile, Andrés Santa Cruz interpreted Sucre's opening to Buenos Aires as an attempt to form "an anti-popular and very particularly anti-Peruvian pact." The negotiations did not prosper because the Peruvians also sent agents who assured that Bolívar intended to divide the continent between two great empires: one Colombian and the other Brazilian.
Sources: en.wikipedia.org
==== JPT2 ==== The 20kDa Jupiter microtubule-associated homolog 2 (JPT2) (also known as HN1L) was the first accessory protein to be published as a mediator of NAADP-dependent Ca2+ release. Both studies exploited the same novel 'clickable' NAADP photoprobe, but regardless of the different blood cell types, the authors converged on the same molecular partner (although the studies differ in the channel that is activated). JPT2 binds [32P]NAADP with selectivity over a spectrum of different nucleotides. In Ca2+-release studies, NAADP-dependent signals were inhibited by siRNA knockdown of JPT2, but not of its homolog, JPT1, attesting to isoform specificity. Interestingly, JPT2 exhibited a preferential interaction with TPC1 over TPC2. Given that TPCs are known to drive pathogen uptake into cells, it was striking that uptake of a Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) pseudovirus was likewise reduced by JPT2 gene silencing.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
=== Tumor detection === In cancer research, colloidal gold can be used to target tumors and provide detection using SERS (surface enhanced Raman spectroscopy) in vivo. These gold nanoparticles are surrounded with Raman reporters, which provide light emission that is over 200 times brighter than quantum dots. It was found that the Raman reporters were stabilized when the nanoparticles were encapsulated with a thiol-modified polyethylene glycol coat. This allows for compatibility and circulation in vivo. To specifically target tumor cells, the polyethylenegylated gold particles are conjugated with an antibody (or an antibody fragment such as scFv), against, e.g. epidermal growth factor receptor, which is sometimes overexpressed in cells of certain cancer types. Using SERS, these pegylated gold nanoparticles can then detect the location of the tumor. Gold nanoparticles accumulate in tumors, due to the leakiness of tumor vasculature, and can be used as contrast agents for enhanced imaging in a time-resolved optical tomography system using short-pulse lasers for skin cancer detection in mouse model. It is found that intravenously administered spherical gold nanoparticles broadened the temporal profile of reflected optical signals and enhanced the contrast between surrounding normal tissue and tumors.
Sources: en.wikipedia.org
Major regulatory agencies have not approved it for any indication. Some countries permit it only under prescription frameworks, while others classify it as a controlled substance.
Much of the evidence comes from case reports and accounts of unregulated use rather than controlled trials. Differences in product purity and dosing add further variability.
Laboratory work focuses on receptor binding and cellular signalling. Observational reports document outcomes after use, and analytical chemists examine samples to assess content and purity.
No. It is a laboratory-made peptide, while the natural hormone is alpha-melanocyte-stimulating hormone, a longer peptide produced by the pituitary gland and by skin cells. Melanotan-2 mimics only a short active region of that hormone and contains non-natural residues such as D-phenylalanine.