If you have been reading about melanocortin receptor and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-12-13. Numbers and descriptions here follow the published literature rather than marketing material.
Regulatory treatment varies by country. In the United States the peptide is not approved as a medicine, and products offered for human use may be treated as unapproved new drugs; some states also restrict sale. Australia, the United Kingdom, and European Union member states apply comparable restrictions to unapproved peptide products. Border agencies have seized shipments labelled as research chemicals. Classification may change over time, and the legal position for personal importation is not clearly settled in most published guidance.
Lyophilised melanotan-2 is supplied as a solid, which is more stable than a solution. The material is hygroscopic, so weighing is done quickly, in low humidity, with the container kept sealed. Reconstitution usually uses water for injection or bacteriostatic water, added down the wall of the vial to limit foaming. A reconstituted solution is held at 2 to 8 °C and kept away from light. Repeated freezing and thawing of the same vial is avoided because ice crystal formation and concentration effects degrade the peptide.
Reversed-phase high-performance liquid chromatography is the routine method for purity assessment. Peptides absorb near 214 nm because of the peptide bond, and a gradient of acetonitrile in water separates the intact peptide from deletion sequences, oxidised products, and earlier-eluting fragments at neutral pH. Electrospray ionisation mass spectrometry provides an orthogonal check: the measured mass must agree with the theoretical value. Amino acid analysis and peptide mapping confirm structure but are used less often. Reference standards remain scarce because the peptide is not described in any pharmacopoeia.
Published human data come mostly from small, short studies rather than large controlled trials. Reported outcomes include increased skin pigmentation and, in some reports, effects on appetite and libido, but sample sizes are small and follow-up is limited. Whether long-term use produces durable pigment changes or adverse effects is not established. Because products sold outside pharmacies are not standardized, the actual content of any given vial is often unknown. Independent testing of such material is uncommon.
Melanotan II is a synthetic cyclic heptapeptide analog derived from the core sequence of alpha-melanocyte-stimulating hormone. Researchers at the University of Arizona synthesized it during the 1980s while studying pigmentation and appetite signaling. The compound is not an approved medicine in any major jurisdiction and appears mainly in laboratory and research-chemical settings. Its structure incorporates a lactam bridge between side chains, which constrains the ring and slows enzymatic breakdown relative to the natural hormone.
| Property | Value | Notes |
|---|---|---|
| Lyophilised storage | −20 °C, dry, protected from light | Vials are sealed and allowed to reach room temperature before opening |
| Reconstituted storage | 2 to 8 °C, protected from light | Short-term holding; avoid repeated freeze-thaw cycles |
| Reconstitution solvent | Water for injection or bacteriostatic water | Added slowly along the vial wall to reduce foaming and shear |
| Purity measurement | RP-HPLC with area normalisation | Acetonitrile-water gradient monitored at roughly 214 nm |
| Identity confirmation | Electrospray ionisation mass spectrometry | Observed mass compared against the calculated peptide mass |
Because the substance circulates mainly through informal markets, verification is a recurring theme in technical discussion. Independent analyses have found that labeled content and actual content can diverge, and that purity varies between samples. Analytical laboratories use reversed-phase chromatography to separate components and mass spectrometry to confirm identity. Isotope-labeled internal standards improve quantification in complex matrices. Such methods describe what a sample contains but say nothing about its sterility, lawful status, or suitability for any use. Open questions remain about how consistently testing is applied across the supply chain.
Regulatory treatment of this peptide varies by country. It holds no marketing authorization as a medicine in the United States, the European Union, or most other jurisdictions. Some countries classify products containing it as prescription-only or unlicensed medicines, which restricts lawful supply. Authorities have issued public notices warning that unregulated products may contain undeclared or incorrect ingredients. The molecule also appears on prohibited lists for competitive sport. These measures address supply oversight rather than any approved therapeutic role.
Published research on the compound remains limited. Much of the human data comes from small, early-stage studies rather than large controlled trials, and several questions about effects and variability between individuals remain open. Investigators have examined receptor activity, pigment pathways, and related physiological responses in laboratory and animal models. Findings from those models do not automatically translate to human outcomes. Reviews frequently note the scarcity of rigorous clinical evidence and call for better-characterized study material.
Receptor-binding studies classify melanotan II as a non-selective melanocortin agonist. It interacts with MC1R, MC3R, MC4R and MC5R, with reported affinities in the low nanomolar range and no strong subtype preference. Activation of MC1R on dermal melanocytes shifts pigment synthesis toward eumelanin, the dark polymer deposited in melanosomes and transferred to keratinocytes. Because the same peptide engages MC4R in the hypothalamus, it also appears in animal work on food intake and erectile response, which is why it is discussed in both pigment and metabolic research. Which receptor populations dominate after systemic exposure in humans is not fully established.
Published pharmacokinetic information is limited and comes mainly from small studies rather than registrational trials. Plasma half-life is usually described as short, on the order of tens of minutes, followed by rapid tissue distribution and clearance of the intact peptide. Metabolites and low concentrations of parent compound have been reported in urine, a detail relevant to anti-doping and forensic testing. Whether repeated exposure changes receptor sensitivity or clearance over time remains an open question. Values differ noticeably between analytical assays, so published numbers should be read as approximate rather than definitive.
Melanotan II is a synthetic cyclic heptapeptide with the sequence Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, corresponding to a molecular formula of C50H69N15O9 and a monoisotopic mass near 1024 daltons. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, a peptide hormone produced by cleavage of proopiomelanocortin. A lactam bridge between the aspartate and lysine side chains closes the ring, and the C-terminal amide removes a free carboxyl group. Both modifications increase resistance to enzymatic degradation compared with the linear parent hormone. Four substitutions distinguish it from afamelanotide, the linear analogue studied under the name melanotan I.
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
Shaving or trimming (manually or with electric shavers which can be used on pubic hair or body hair) Depilatories (creams or "shaving powders" which chemically dissolve hair) Friction (rough surfaces used to buff away hair)
=== Vietnamese === Vietnamese is an isolating language, which naturally limits the length of a morpheme. The longest, at seven letters, is nghiêng, which means "inclined" or "to lean". This is the longest word that can be written without a space. However, not all words in Vietnamese are single morphemes. Indeed, nghiêng can be reduplicated as nghiêng nghiêng. The written language abounds with compound words in which each constituent word is delimited by spaces, just like any freestanding word. Moreover, the grammar lacks inflection to mark parts of speech, and prepositions are often optional. Therefore, the boundary between a word and a phrase is poorly defined. Examples of this ambiguity include:
== ARL Development == ARL Development is a non-profit company that was formed by the ARL to develop the sport from an introductory level to the age of 18 years. In achieving this, ARL Development has developed new modified codes that gradually introduce children to rugby league. This is done by restricting the rules and then gradually releasing these restrictions. The two introductory modified codes currently in use are mini footy and mod league. On completion of mod league, players make a move to full international rugby league laws.
The oldest known fabric dyed indigo, dated to 6,000 years ago, was discovered in Huaca Prieta, Peru. Many Asian countries, such as India, China, Japan, and Southeast Asian nations have used indigo as a dye (particularly for silk) for centuries. The dye was also known to ancient civilizations in Mesopotamia, Egypt, Britain, Mesoamerica, Peru, Iran, and West Africa. Indigo was also cultivated in India, which was also the earliest major center for its production and processing. The Indigofera tinctoria species was domesticated in India. Indigo, used as a dye, made its way to the Greeks and the Romans, where it was valued as a luxury product. In Mesopotamia, a neo-Babylonian cuneiform tablet of the seventh century BC gives a recipe for the dyeing of wool, where lapis-colored wool (uqnatu) is produced by repeated immersion and airing of the cloth. Indigo was most probably imported from India. The Romans used indigo as a pigment for painting and for medicinal and cosmetic purposes. It was a luxury item imported to the Mediterranean from India by Arab merchants.
Sources: en.wikipedia.org
Tarichatoxin was shown to be identical to TTX in 1964 by Mosher et al., and the identity of maculotoxin and TTX was reported in Science in 1978, and the synonymity of these two toxins is supported in modern reports (e.g., at Pubchem and in modern toxicology textbooks) though historic monographs questioning this continue in reprint. The toxin is variously used by animals as a defensive biotoxin to ward off predation, or as both a defensive and predatory venom (e.g., in octopuses, chaetognaths, and ribbon worms). Even though the toxin acts as a defense mechanism, some predators such as the common garter snake have developed insensitivity to TTX, which allows them to prey upon toxic newts. The association of TTX with consumed, infecting, or symbiotic bacterial populations within the animal species from which it is isolated is relatively clear; presence of TTX-producing bacteria within an animal's microbiome is determined by culture methods, the presence of the toxin by chemical analysis, and the association of the bacteria with TTX production by toxicity assay of media in which suspected bacteria are grown. As Lago et al. note, "there is good evidence that uptake of bacteria producing TTX is an important element of TTX toxicity in marine animals that present this toxin." TTX-producing bacteria include Actinomyces, Aeromonas, Alteromonas, Bacillus, Pseudomonas, and Vibrio species; in the following animals, specific bacterial species have been implicated:
=== 18 July === General al-Burhan ordered the SAF's withdrawal from Khartoum as part of efforts to end looting. The European Union imposed sanctions on SAF commander Abuqala Mohamed Kaikal, RSF commander Hussein Barsham and the firms Al-Khaleej Bank and Red Rock Mining.
== Role in cancer metastasis == Cancer metastasis is the process by which a tumor spreads from its place of origin in the body to distant tissues. Cancer cells and tumors have been known to produce and respond to electrical currents within the body. Cancer cells isolated from brain, prostate, and lung tumors have all been observed to have electrotaxis responses, and there is evidence suggesting that electrotaxis may play a role in cancer cell metastasis.
Retailing in India is a pillar of the national economy accounting for about 10 percent of GDP. The Indian retail market is estimated to be worth $1.3 trillion as of 2022. India is one of the fastest growing retail markets in the world, with 1.4 billion people. As of 2003, India's retailing industry was essentially owner staffed small shops. In 2010, larger format convenience stores and supermarkets accounted for about 4 percent of the industry, and these were present only in large urban centers. India's retail and logistics industry employs about 40 million Indians (3.3% of Indian population). In November 2011, India's central government announced retail reforms for both multi-brand stores and single-brand stores. These market reforms paved the way for retail innovation and competition with multi-brand retailers such as Walmart, Carrefour and Tesco, as well single brand majors such as IKEA, Nike, and Apple. The announcement sparked intense activism, both in opposition and in support of the reforms. In December 2011, under pressure from the opposition, Indian government placed the retail reforms on hold until a consensus was reached. In January 2012, India approved reforms for single-brand stores welcoming anyone in the world to innovate in Indian retail market with 100% ownership, but imposed the requirement that the single brand retailer source 30 percent of its goods from India. Indian government continues the hold on retail reforms for multi-brand stores.
=== Processed tofu === Many forms of processed tofu exist. Some processing techniques probably originate before the days of refrigeration from the need to preserve tofu or to increase its shelf life. Other production techniques are employed to create tofus with different textures and flavors.
Sources: en.wikipedia.org
Filter papers are widely used in laboratory experiments across many different fields, from biology to chemistry. The type of filter used will differ according to the purpose of the procedure and the chemicals involved. Generally, filter papers are used with laboratory techniques such as gravity or vacuum filtration. Historically, a type of soft, porous paper called charta emporetica was used in pharmacy as a filter and as packing paper.
Estrogens can be produced in the brain from steroid precursors. As antioxidants, they have been found to have neuroprotective function. The positive and negative feedback loops of the menstrual cycle involve ovarian estradiol as the link to the hypothalamic-pituitary system to regulate gonadotropins. Estrogen is considered to play a significant role in women's mental health, with links suggested between the hormone level, mood and well-being. Sudden drops or fluctuations in, or long periods of sustained low levels of estrogen may be correlated with significant mood-lowering. Clinical recovery from depression postpartum, perimenopause, and postmenopause was shown to be effective after levels of estrogen were stabilized and/or restored. The volumes of sexually dimorphic brain structures in transgender women were found to change and approximate typical female brain structures when exposed to estrogen concomitantly with androgen deprivation over a period of months, suggesting that estrogen and/or androgens have a significant part to play in sex differentiation of the brain, both prenatally and later in life. There is also evidence the programming of adult male sexual behavior in many vertebrates is largely dependent on estradiol produced during prenatal life and early infancy. It is not yet known whether this process plays a significant role in human sexual behavior, although evidence from other mammals tends to indicate a connection.
Correct functioning of agouti requires DNA methylation. Methylation occurs in six guanine-cytosine (GC) rich sequences in the 5’ long terminal repeat of the IAP element in the viable yellow mutation. Methylation on a gene causes the gene to not be expressed because it will cause the promoter to be turned off. In utero, the mother's diet can cause methylation or demethylation. When this area is unmethylated, ectopic expression of agouti occurs, and yellow phenotypes are shown because the phaeomelanin is expressed instead of eumelanin. When the region is methylated, agouti is expressed normally, and grey and brown phenotypes (eumelanin) occur. The epigenetic state of the IAP element is determined by the level of methylation, as individuals show a wide range of phenotypes based on their degree of DNA methylation. Increased methylation is correlated with increased expression of the normal agouti gene. Low levels of methylation can induce gene imprinting which results in offspring displaying consistent phenotypes to their parents, as ectopic expression of agouti is inherited through non-genomic mechanisms. DNA methylation is determined in utero by maternal nutrition and environmental exposure. Methyl is synthesized de novo but attained through the diet by folic acid, methionine, betaine, and choline, as these nutrients feed into a consistent metabolic pathway for methyl synthesis. Adequate zinc and vitamin B12 are required for methyl synthesis as they act as cofactors for transferring methyl groups.
=== The Benthic Filter === The organisms living at cold seeps have a large impact on the carbon cycle and on climate. Chemosynthetic organisms, specifically methanogenic (methane-consuming) organisms, prohibit the methane seeping up from beneath the seafloor from being released into the water above. Since methane is such a potent greenhouse gas, methane release could cause global warming when gas hydrate reservoirs destabilized. The consumption of methane by aerobic and anaerobic seafloor life is called "the benthic filter". The first part of this filter is the anaerobic bacteria and archaea underneath the seafloor that consume methane through the anaerobic oxidation of methane (AOM). If the flux of methane flowing through the sediment is too large, and the anaerobic bacteria and archaea are consuming the maximum amount of methane, then the excess methane is consumed by free-floating or symbiotic aerobic bacteria above the sediment at the seafloor. The symbiotic bacteria have been found in organisms such as tube worms and clams living at cold seeps; these organisms provide oxygen to the aerobic bacteria as the bacteria provide energy they obtain from the consumption of methane. Understanding how efficient the benthic filter is can help predict how much methane escapes the seafloor at cold seeps and enters the water column and eventually the atmosphere. Studies have shown that 50–90% of methane is consumed at cold seeps with bacterial mats. Areas with clam beds have less than 15% of methane escaping. Efficiency is determined by a number of factors.
Sources: en.wikipedia.org
Low temperature slows hydrolysis and oxidation, the two main routes by which the peptide backbone and side chains are modified. A lyophilised powder stored at −20 °C is more stable than one kept at room temperature, and once the material is dissolved the degradation rate rises, making refrigeration more important.
Liquid chromatography coupled to mass spectrometry is the most common approach because it combines a retention time with a mass measurement. A chromatographic peak alone cannot establish which peptide is present, so mass determination or amino acid analysis is used as an orthogonal confirmation alongside the separation.
This depends on buffer, pH, and concentration, and published stability data for this peptide are limited. In practice laboratories work through a refrigerated solution within a few weeks and discard samples that show cloudiness or visible particles. Freezing and thawing repeatedly is generally discouraged.
No regulator in a major market has approved it for human use. It appears in research settings and in products marketed outside pharmacy channels. Legal status for personal possession varies by country.